DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and CG4502

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:395 Identity:124/395 - (31%)
Similarity:183/395 - (46%) Gaps:99/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQEIKT-LEKIFPKNHERFQILNSSVDELLCRFIDKNGKRYDIHANITETYPSSPPVWFAESEET 71
            |:.:.| ..|||.|:.                  :.|....:.|.|......::..|..|.....
  Fly     6 KERVVTAFRKIFHKSS------------------NNNNNNNNNHNNNINNNNNNDKVDGATGSSP 52

  Fly    72 SVTNAVQILSNTNGRDNHVINQVGILLRELCRLHNVPLPPDIDNLALPLQTPPPSASPLRCEQRP 136
            ::.|.   .:|.|..:||                        |..|.|              ...
  Fly    53 NINNN---NNNNNNNNNH------------------------DGAAAP--------------SSA 76

  Fly   137 GG----GGAGGGGGPHGNEETDSDQEEIEDPIGESEQESEGDEDLPLEMDDVRSTSKKDDMEVEH 197
            ||    |||.|..|..|..:....:...|..:.:|.                 ...::.|.:|  
  Fly    77 GGVAVAGGAVGSSGSSGAAKNAVVRMAAEQAVWDSP-----------------GKRRRQDHKV-- 122

  Fly   198 LATLEKLRQSQRQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLK 262
                  ...::||  |..:...::: |.|||||.|::.|..|....::::||||:|::||::||.
  Fly   123 ------APTTERQ--LVAAPDHTIR-TRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLH 178

  Fly   263 SVDPDSPLHSDLQMLKEKEGKDSILLNILFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLT 327
            .:||||||..|:..:    |..:|||::.|.:.:||.|||:|||.|.|..|||:.||||||||||
  Fly   179 VIDPDSPLARDMAEM----GVPAILLHLSFPDNFPFAPPFMRVVEPHIEKGYVMEGGAICMELLT 239

  Fly   328 KQGWSSAYTVEAVIMQIAATLVKGKARIQFGATKALTQGQYSLARAQQSFKSLVQIHEKNGWFTP 392
            .:||:|||||||||||.||::|||:.||   |.|..:..:::..:|::||:|||:.|||.||.||
  Fly   240 PRGWASAYTVEAVIMQFAASVVKGQGRI---ARKPKSTKEFTRRQAEESFRSLVKTHEKYGWVTP 301

  Fly   393 PKEDG 397
            ...||
  Fly   302 ALSDG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 68/124 (55%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 66/121 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442212
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0897
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103474at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.