DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and morgue

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:182 Identity:40/182 - (21%)
Similarity:68/182 - (37%) Gaps:51/182 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RQDYLKGSVSGSVQATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSD 273
            |.::|:|..:            |.:.|.|:...    :|.|..::.| |...:.. .|.||... 
  Fly   338 RNNFLRGEAN------------LLNSYESEGIS----AIPLDRQNNY-WQATILG-PPGSPYEG- 383

  Fly   274 LQMLKEKEGKDSILLNILFKETYPFEPPFVR----VVHPIISGGYVLIGGAICMELLTKQGWSSA 334
                    ||  ..|.|.|.|.||..||.||    ::||.:|.     .|.:.:::..:..||.|
  Fly   384 --------GK--FFLFIYFPERYPMTPPTVRFLTKILHPNVSR-----HGDVGIDIFQQHNWSLA 433

  Fly   335 YTVEAVIMQIAATLVKGKARI----QFGATKALTQGQYSLARAQQSFKSLVQ 382
            ..|..|::.:.:.|......:    :.|         |.....::.|:.||:
  Fly   434 LNVAKVLLSVQSLLTDPYTEVCMEPELG---------YIYEHERERFEQLVR 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 31/128 (24%)
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 39/178 (22%)
COG5078 355..485 CDD:227410 34/153 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.