DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and CG8188

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:193 Identity:40/193 - (20%)
Similarity:75/193 - (38%) Gaps:43/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 SVQATDRLMKELRDIYRS--DAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEG 282
            |.|...::|:||:::..:  :..|      .|:|||.......|......:|..:.:..:|....
  Fly    12 SPQTIRQVMRELQEMETTPPEGIK------VLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLN 70

  Fly   283 KDSILLNILFKETYPFEPP----FVRVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQ 343
            ||           :|..||    ..::.||.::.     .|.||:..| |:.|.....::.:::.
  Fly    71 KD-----------FPLTPPKAYFLTKIFHPNVAA-----NGEICVNTL-KKDWKPDLGIKHILLT 118

  Fly   344 IAATLV--KGKARIQFGATKALTQ--GQYSLARAQQSFKSLVQIHEKN-----GWFTPPKEDG 397
            |...|:  ..::.:...|.|.|.:  ..||     |..:.:.:||.:.     |.....|:||
  Fly   119 IKCLLIVPNPESALNEEAGKMLLERYDDYS-----QRARMMTEIHAQPAKCGVGAVGDAKDDG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 25/130 (19%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 35/174 (20%)
UBCc 16..155 CDD:238117 32/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.