DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and ube2e3

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_957215.2 Gene:ube2e3 / 321689 ZFINID:ZDB-GENE-030131-408 Length:209 Species:Danio rerio


Alignment Length:207 Identity:53/207 - (25%)
Similarity:83/207 - (40%) Gaps:65/207 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TDSDQEEIEDPIGESEQESEGDEDLPLEMD--DVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKG 215
            :|:||.::  |:.|.|::.|..:..|.:..  ..:.:||          |..||..|.:      
Zfish    20 SDADQRDL--PVPEPEEQEERKQPTPPQQQKKSTKLSSK----------TTAKLSSSAK------ 66

  Fly   216 SVSGSVQATDRLMKELRDIY-----RSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQ 275
                      |:.|||.:|.     ...|..|        .::||||  |...:.|...::    
Zfish    67 ----------RIQKELAEITLDPPPNCSAGPK--------GDNIYEW--RSTILGPPGSVY---- 107

  Fly   276 MLKEKEGKDSILLNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYT 336
                 || ....|:|.|...|||:||.|    |:.|..|:.     .|.||:::| |..||.|.|
Zfish   108 -----EG-GVFFLDITFSSDYPFKPPKVTFRTRIYHCNINS-----QGVICLDIL-KDNWSPALT 160

  Fly   337 VEAVIMQIAATL 348
            :..|::.|.:.|
Zfish   161 ISKVLLSICSLL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 39/134 (29%)
ube2e3NP_957215.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.