DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ube2l6

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001019926.1 Gene:Ube2l6 / 295704 RGDID:1307960 Length:153 Species:Rattus norvegicus


Alignment Length:164 Identity:40/164 - (24%)
Similarity:70/164 - (42%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDS-PLHSDLQMLKEKEGKDSI 286
            |:.|:.|||.|:  |......:..:...:.::..|::.|.   ||. |..     ||      :.
  Rat     3 ASKRVAKELDDL--SKELPPYLRHLSSDDANVLVWHMLLL---PDQLPYR-----LK------AF 51

  Fly   287 LLNILFKETYPFEPPFVR----VVHPIISGGYVLIGGAICMELLTKQGW---SSAYTV-EAVIMQ 343
            .|.|.|...||.:||.:|    :.||.||.     .|.:|:.|::.:.|   :.||.| ||:.:.
  Rat    52 GLRIDFPREYPLKPPTLRFTTKIYHPNISE-----DGLVCLPLISTENWKPYTKAYQVLEALNIL 111

  Fly   344 IAATLVKGKARIQFGATKALTQGQYSLARAQQSF 377
            ::...::...|::.  ...|||......:..:.|
  Rat   112 VSRPNLEEPVRLEL--ADLLTQDPEMFRKKAEEF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 34/133 (26%)
Ube2l6NP_001019926.1 COG5078 1..147 CDD:227410 40/164 (24%)
UQ_con 6..144 CDD:278603 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.