DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and Ube2dnl1

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001263325.1 Gene:Ube2dnl1 / 237009 MGIID:3646570 Length:155 Species:Mus musculus


Alignment Length:133 Identity:38/133 - (28%)
Similarity:59/133 - (44%) Gaps:31/133 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ATDRLMKELRDIYRSDAFKKN---MYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKD 284
            |..|:.|||      .||.::   ..|...|.|:::.|...:...: |||....:          
Mouse    10 ALKRIQKEL------VAFSQDPPAHCSAGPVAENMFHWQATIMGPE-DSPYQGGV---------- 57

  Fly   285 SILLNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIA 345
             ..|:|.|...|||:||.|    |:.||.||.     .|:||:::|..: ||...|:..|::.|.
Mouse    58 -FFLSIHFPNNYPFKPPKVSFITRIYHPNISK-----NGSICLDILNSK-WSPTLTISKVLLSIC 115

  Fly   346 ATL 348
            :.|
Mouse   116 SLL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 37/132 (28%)
Ube2dnl1NP_001263325.1 COG5078 9..155 CDD:227410 38/133 (29%)
UBCc 9..154 CDD:294101 38/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.