DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and UBE2QL1

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_024310129.1 Gene:UBE2QL1 / 134111 HGNCID:37269 Length:267 Species:Homo sapiens


Alignment Length:173 Identity:93/173 - (53%)
Similarity:121/173 - (69%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 RLMKELRDIYR-SDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLN 289
            ||||||:||.| ||.|    .|:|||:||:::||::|..||.||.|..|:    ::...:.||||
Human   105 RLMKELQDIARLSDRF----ISVELVDESLFDWNVKLHQVDKDSVLWQDM----KETNTEFILLN 161

  Fly   290 ILFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKAR 354
            :.|.:.:||.|||:||:.|.:..||||.||||||||||.:|||||||||||:.|.||:||||:.|
Human   162 LTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGR 226

  Fly   355 IQFGATKALTQGQYSLARAQQSFKSLVQIHEKNGWFTPPKEDG 397
            |...|.|  ::..:|...|:.:|||||:.|||.||.|||..||
Human   227 ICRKAGK--SKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 68/123 (55%)
UBE2QL1XP_024310129.1 UBCc 103..>221 CDD:238117 68/123 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.