DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2924 and ube2ql1

DIOPT Version :9

Sequence 1:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_002933164.1 Gene:ube2ql1 / 100486993 XenbaseID:XB-GENE-6073410 Length:328 Species:Xenopus tropicalis


Alignment Length:302 Identity:119/302 - (39%)
Similarity:163/302 - (53%) Gaps:59/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EQRPGGGGAGGGGGPHG----------NEETDSD----QEEIEDPIGESEQESEGDEDL---PLE 180
            :|:.||...|||||..|          |..|.:|    |.||:   |:..:::..|:..   ..|
 Frog    49 QQQQGGSAGGGGGGSCGGGSSGCCSSSNNTTTTDGILGQPEIK---GKKAEQAHKDKHCIAGGKE 110

  Fly   181 MDDVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSG------SVQ-------------ATDR 226
            ....|.||         ..|:.|..:.|......|.|.|      |:|             .:.|
 Frog   111 KSSARETS---------TPTITKESKQQGGVAGNGGVGGKQSGGSSLQPLVPPNRQHCTQVRSRR 166

  Fly   227 LMKELRDIYR-SDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSILLNI 290
            |||||:||.: :|.|    .|:|||::|:::||::|..||.||.|..|:    ::...:.||||:
 Frog   167 LMKELQDIRKLNDHF----ISVELVDDSLFDWNVKLHQVDKDSTLWQDM----KETNTEYILLNL 223

  Fly   291 LFKETYPFEPPFVRVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAATLVKGKARI 355
            .|.:.:||.|||:||:.|.:..||||.||||||||||.:|||||||||||:.|.||:||||:.||
 Frog   224 TFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRI 288

  Fly   356 QFGATKALTQGQYSLARAQQSFKSLVQIHEKNGWFTPPKEDG 397
            ...|.|  ::..:|...|:.:|||||:.|||.||.|||..||
 Frog   289 CRKAGK--SKKAFSRKEAEATFKSLVKTHEKYGWVTPPVSDG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 65/125 (52%)
ube2ql1XP_002933164.1 UBCc 164..>282 CDD:238117 65/125 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.