DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3071 and TAF5

DIOPT Version :9

Sequence 1:NP_569993.1 Gene:CG3071 / 31213 FlyBaseID:FBgn0023527 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_197897.3 Gene:TAF5 / 832586 AraportID:AT5G25150 Length:669 Species:Arabidopsis thaliana


Alignment Length:262 Identity:63/262 - (24%)
Similarity:109/262 - (41%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YGATFRQDGRLLAAGDEEGHVKLFDTTSRNILRLFKGHTAPVHRTFFTADKLQLASFGDDKSVRL 149
            |.|||...|..:.:...:..::|:.|.....|..:|||..||....|:......||...|::.|:
plant   422 YSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDAQFSPFGHYFASCSHDRTARI 486

  Fly   150 WDVANEKVVQTYEDTHTDYVRAGAMHPQAGHMFVSGGYDGKIKLYDTRAETAVQRTLDHGAPVES 214
            |.:...:.::.... |...|.....||...:: .:|..|..::|:|.:....|:..:.|.:.|.|
plant   487 WSMDRIQPLRIMAG-HLSDVDCVQWHPNCNYI-ATGSSDKTVRLWDVQTGECVRIFIGHRSMVLS 549

  Fly   215 MLFLPNGSIFVSAGGSQ--VRVWDLISGCRLLTMMSQHHKTVTCLRLGSDGRRLLSGGLDRHVKI 277
            :...|:|. ::::|...  :.:||| |..|.:|.:..|:..|..|....:|..|.||..|..||:
plant   550 LAMSPDGR-YMASGDEDGTIMMWDL-STARCITPLMGHNSCVWSLSYSGEGSLLASGSADCTVKL 612

  Fly   278 YDVSTYKTVHTLTYPNAVVSMAVADGDQAVVAGMVDGLVSIRRMMVDSKPSHLKKIRADRARKYF 342
            :||::...:......|                |..:.|.|:|.....|.|.|  .:|..|....|
plant   613 WDVTSSTKLTKAEEKN----------------GNSNRLRSLRTFPTKSTPVH--ALRFSRRNLLF 659

  Fly   343 VS 344
            .:
plant   660 AA 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3071NP_569993.1 WD40 <26..283 CDD:225201 52/199 (26%)
WD40 repeat 87..121 CDD:293791 7/33 (21%)
WD40 89..318 CDD:238121 52/230 (23%)
WD40 repeat 126..162 CDD:293791 7/35 (20%)
WD40 repeat 170..206 CDD:293791 7/35 (20%)
WD40 repeat 212..247 CDD:293791 11/36 (31%)
WD40 repeat 254..288 CDD:293791 11/33 (33%)
WD40 repeat 295..318 CDD:293791 2/22 (9%)
UTP15_C 352..494 CDD:286472
TAF5NP_197897.3 TFIID_NTD2 64..188 CDD:398277
WD40 repeat 357..416 CDD:293791
WD40 414..663 CDD:238121 63/262 (24%)
WD40 repeat 422..458 CDD:293791 8/35 (23%)
WD40 repeat 463..499 CDD:293791 7/35 (20%)
WD40 repeat 506..541 CDD:293791 7/35 (20%)
WD40 repeat 547..583 CDD:293791 11/37 (30%)
WD40 repeat 589..622 CDD:293791 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.