DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3071 and AT2G47790

DIOPT Version :9

Sequence 1:NP_569993.1 Gene:CG3071 / 31213 FlyBaseID:FBgn0023527 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_566111.1 Gene:AT2G47790 / 819391 AraportID:AT2G47790 Length:392 Species:Arabidopsis thaliana


Alignment Length:168 Identity:38/168 - (22%)
Similarity:69/168 - (41%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VQIYNLVTMLVVKNLSRFQKTAYGATFRQDG----RLLAAGDEEGHVKLFDTTS-RNILRLFKGH 122
            |::|:.||............|.....|..|.    .:|.:...:|.::.:||.| :.:.|:..|:
plant    65 VKLYSPVTGQYYGECKGHSDTVNQIAFSSDSAASPHVLHSCSSDGTIRSWDTRSFQQVSRIDTGN 129

  Fly   123 TAPVHRTFFTADKLQLASFGDDKSVRLWDVANEKVVQTYEDTHTDYVRAGAMHPQAGHMFVSGGY 187
            ...:....:......|.:.|..:.|.|||..|.|.|...|::|.|.|......|...:..:|...
plant   130 DQEIFSFSYGGAADNLLAGGCKEQVLLWDWRNSKQVACLEESHMDDVTQVHFVPNKPNKLLSASV 194

  Fly   188 DGKIKLYDTRA----ETAVQRTLDHGAPVESMLFLPNG 221
            ||.|.|::|..    :..::..::.|..:..:.||.:|
plant   195 DGLICLFNTEGDINDDDHLESVINVGTSIGKIGFLGDG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3071NP_569993.1 WD40 <26..283 CDD:225201 38/168 (23%)
WD40 repeat 87..121 CDD:293791 8/38 (21%)
WD40 89..318 CDD:238121 33/142 (23%)
WD40 repeat 126..162 CDD:293791 9/35 (26%)
WD40 repeat 170..206 CDD:293791 7/39 (18%)
WD40 repeat 212..247 CDD:293791 3/10 (30%)
WD40 repeat 254..288 CDD:293791
WD40 repeat 295..318 CDD:293791
UTP15_C 352..494 CDD:286472
AT2G47790NP_566111.1 WD40 <41..275 CDD:225201 38/168 (23%)
WD40 repeat 43..81 CDD:293791 4/15 (27%)
WD40 repeat 87..128 CDD:293791 8/40 (20%)
WD40 repeat 133..169 CDD:293791 9/35 (26%)
WD40 repeat 177..210 CDD:293791 7/32 (22%)
WD40 repeat 217..261 CDD:293791 4/16 (25%)
WD40 repeat 269..321 CDD:293791
WD40 repeat 328..358 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.