DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3071 and TLE3

DIOPT Version :9

Sequence 1:NP_569993.1 Gene:CG3071 / 31213 FlyBaseID:FBgn0023527 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_011520278.1 Gene:TLE3 / 7090 HGNCID:11839 Length:782 Species:Homo sapiens


Alignment Length:293 Identity:59/293 - (20%)
Similarity:115/293 - (39%) Gaps:40/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KTAYGATFRQDGRL---------LAAGDEEGHVKLFDTTSRNILRLFKGHTAPVHRTFFTADKLQ 137
            |.||......||::         ||......|.:..:|.|...:......:.|....:       
Human   455 KPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVY------- 512

  Fly   138 LASFGDDKSVRLWDVA---NEKVVQTYEDTHTD-YVRAGAMHPQAGHMFVSGGYDGKIKLYDTRA 198
               .|....|::||::   ::..:...:..:.| |:|:..:.|. |...:.||....:.::|..:
Human   513 ---TGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPD-GRTLIVGGEASTLTIWDLAS 573

  Fly   199 ET-AVQRTLDHGAPV-ESMLFLPNGSI-FVSAGGSQVRVWDLISGCRLLTMMSQHHKTVTCLRLG 260
            .| .::..|...||. .::...|:..: |.......:.|||| ....|:.....|....:|:.:.
Human   574 PTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDL-HNQTLVRQFQGHTDGASCIDIS 637

  Fly   261 SDGRRLLSGGLDRHVKIYDVSTYKTVHTLTYPNAVVSMAVADGDQAVVAGMVDGLVSIRRMMVDS 325
            .||.:|.:||||..|:.:|:...:.:....:.:.:.|:......:.:..||....|.:   :..:
Human   638 HDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEV---LHHT 699

  Fly   326 KPS----HLKK-----IRADRARKYFVSTKRTN 349
            ||.    ||.:     ::.....|:||||.:.|
Human   700 KPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3071NP_569993.1 WD40 <26..283 CDD:225201 45/216 (21%)
WD40 repeat 87..121 CDD:293791 7/42 (17%)
WD40 89..318 CDD:238121 46/244 (19%)
WD40 repeat 126..162 CDD:293791 4/38 (11%)
WD40 repeat 170..206 CDD:293791 7/36 (19%)
WD40 repeat 212..247 CDD:293791 7/36 (19%)
WD40 repeat 254..288 CDD:293791 10/33 (30%)
WD40 repeat 295..318 CDD:293791 4/22 (18%)
UTP15_C 352..494 CDD:286472
TLE3XP_011520278.1 TLE_N 9..143 CDD:397828
WD40 494..779 CDD:238121 50/254 (20%)
WD40 repeat 499..538 CDD:293791 5/48 (10%)
WD40 repeat 546..584 CDD:293791 8/38 (21%)
WD40 repeat 589..625 CDD:293791 7/36 (19%)
WD40 repeat 632..667 CDD:293791 10/34 (29%)
WD40 repeat 672..705 CDD:293791 6/35 (17%)
WD40 repeat 713..747 CDD:293791 6/20 (30%)
WD40 repeat 754..778 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.