DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3071 and SPCC63.06

DIOPT Version :9

Sequence 1:NP_569993.1 Gene:CG3071 / 31213 FlyBaseID:FBgn0023527 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_587980.1 Gene:SPCC63.06 / 2538796 PomBaseID:SPCC63.06 Length:331 Species:Schizosaccharomyces pombe


Alignment Length:324 Identity:69/324 - (21%)
Similarity:129/324 - (39%) Gaps:49/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DNFVVTCSV-RVQIYNLVTMLVVKNLSRFQKTAYG-ATFRQDGRLLAAGDEEGHVKLFDTTS--R 113
            ||.||:.|. ....::..|:|.:..:.:......| .:..|...::..| .||.:.|:|..|  :
pombe    26 DNVVVSYSTGSWSCFDKGTLLEIFKVPKAHTNITGIISCDQLNGVITCG-SEGEIHLWDIRSQAK 89

  Fly   114 NILRLFKGHTAPVHRTFFTADKLQLASFGDD-----KSVRLWDVANE-KVVQTYEDTHTDYVRAG 172
            :.:|.:...:.|.  |....:|....:.|.:     .||:||||.:| |:::.:.|.|.|.:...
pombe    90 SAVRSWTQQSTPF--TCIALNKKNQFATGSELTRSLASVQLWDVRSEQKLIRQWNDAHNDDITHL 152

  Fly   173 AMHPQAGHMFVSGGYDGKIKLYDTRAETAVQRTLDHGAPVESMLFLPNGSIFVSAGGSQVRVWDL 237
            ..||:...:.::|..||.:.|.||..|.      |...|.|..|      :.|...|:.:.:...
pombe   153 QFHPKDNELLLTGSVDGLVSLLDTTKEE------DSTDPEEDPL------LHVINHGASIHLAKF 205

  Fly   238 ISGCRLLTMMSQHHKTVTCLRLGSDGRRLLSGGLDRHVKIYDVSTYKTVHTLTYPNAVVSMAVAD 302
            :|..|::.:.......:..|:...|.:...|.      :::.:...:...:.:|    |...|:.
pombe   206 VSKKRVMVLSHMESYAMYKLKRDKDEKTWSSN------ELFSIDDLRAELSCSY----VINEVST 260

  Fly   303 GDQAVVAGMVDGLVS---IRRMMVDSKPSHLKKIRADRARKYFVSTKRTNNTQEVDHTIKDHVK 363
            .|:...| :..|..|   .:.::||:....|||          ..||....::|:...|...||
pombe   261 SDKQFCA-LAFGDFSNHETKFVLVDTSTGELKK----------EPTKLERASEEICRAISFDVK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3071NP_569993.1 WD40 <26..283 CDD:225201 51/239 (21%)
WD40 repeat 87..121 CDD:293791 8/35 (23%)
WD40 89..318 CDD:238121 50/239 (21%)
WD40 repeat 126..162 CDD:293791 11/41 (27%)
WD40 repeat 170..206 CDD:293791 9/35 (26%)
WD40 repeat 212..247 CDD:293791 6/34 (18%)
WD40 repeat 254..288 CDD:293791 3/33 (9%)
WD40 repeat 295..318 CDD:293791 6/25 (24%)
UTP15_C 352..494 CDD:286472 4/12 (33%)
SPCC63.06NP_587980.1 WD40 5..>331 CDD:225201 69/324 (21%)
WD40 47..>180 CDD:295369 32/135 (24%)
WD40 repeat 59..97 CDD:293791 9/38 (24%)
WD40 repeat 102..142 CDD:293791 11/41 (27%)
WD40 repeat 150..185 CDD:293791 10/40 (25%)
WD40 repeat 200..241 CDD:293791 5/46 (11%)
WD40 repeat 255..298 CDD:293791 12/53 (23%)
Salt_tol_Pase <261..330 CDD:302929 15/64 (23%)
WD40 repeat 305..329 CDD:293791 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.