DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and RAM2

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_012906.3 Gene:RAM2 / 853849 SGDID:S000001502 Length:316 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:43/166 - (25%)
Similarity:72/166 - (43%) Gaps:32/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AKYLNVALLINPDVTTFWHIRRQLV-------QKNRLSINKELQFSALVLSIKPKSNEAFAYRRW 153
            |:.::||    |...|.|:.|..:|       :...|.:||||.:...|....||:.:.::||:.
Yeast    56 AEIIDVA----PAFYTIWNYRFNIVRHMMSESEDTVLYLNKELDWLDEVTLNNPKNYQIWSYRQS 116

  Fly   154 LYSFQSADAIDWPNEIGICERAADRCASNYHAWSHRQWILQNGPCL----LQSELLRTEKFMRKH 214
            |.....:.:  :..|:.|.:...|..:.|||.||:|:|.     ||    .|.||......:...
Yeast   117 LLKLHPSPS--FKRELPILKLMIDDDSKNYHVWSYRKWC-----CLFFSDFQHELAYASDLIETD 174

  Fly   215 ISDYSCYHYRQV-------LLSR---AYELSFALPK 240
            |.:.|.:.:|..       ::|:   |.||.|.:.|
Yeast   175 IYNNSAWTHRMFYWVNAKDVISKVELADELQFIMDK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 10/26 (38%)
RAM2NP_012906.3 BET4 1..316 CDD:227823 43/166 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1452
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.