DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and BET4

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_012503.2 Gene:BET4 / 853421 SGDID:S000003568 Length:327 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:47/206 - (22%)
Similarity:88/206 - (42%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HNLGLESWCAQ-----------HVYDHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAKYLNVALL 104
            |.:..:.|..:           .:||:         |..|...|....::..|....|..:..|.
Yeast     2 HGIKRKQWTKELLRQKRVQDEKKIYDY---------RSLTENVLNMRDEKIYSIEALKKTSELLE 57

  Fly   105 INPDVTTFWHIRRQLVQK--NRLSI---NKELQFSALVLSIKPKSNEAFAYRRW-LYSFQSADAI 163
            .||:....|:.||.::..  :.|.|   :|||.|..::|...||....:.:|.| |..:.::...
Yeast    58 KNPEFNAIWNYRRDIIASLASELEIPFWDKELVFVMMLLKDYPKVYWIWNHRLWVLKHYPTSSPK 122

  Fly   164 DWPNEIGICERAADRCASNYHAWSHRQWILQNGPCLLQSELLRTEKF------MRKHISDYSCYH 222
            .|..|:.:..:..::.|.|||.|.:|:.::.|...:....|.: |:|      :..:||:||.:|
Yeast   123 VWQTELAVVNKLLEQDARNYHGWHYRRIVVGNIESITNKSLDK-EEFEYTTIKINNNISNYSAWH 186

  Fly   223 YRQVLLSRAYE 233
            .|..::||.::
Yeast   187 QRVQIISRMFQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 7/26 (27%)
BET4NP_012503.2 BET4 1..327 CDD:227823 47/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.