DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and RGTA2

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001331841.1 Gene:RGTA2 / 834187 AraportID:AT5G41820 Length:687 Species:Arabidopsis thaliana


Alignment Length:201 Identity:53/201 - (26%)
Similarity:90/201 - (44%) Gaps:43/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AQQLRTLQQQQQSDSLAK-------YLNVALLI-NPDVTTFWHIRRQLVQKNRLS---------- 126
            |.:||:||.|..|:...|       .|:..||| ||:..|.|:..: |..::||.          
plant    19 ALELRSLQSQFMSNHHQKIYTKEAIQLSAKLLITNPEFYTAWNYPK-LAFESRLDEDSDPSLVNS 82

  Fly   127 -INKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADAIDWPNEIGIC------------ERAADR 178
             |::||......|....||..|:.:|:|:.|.:........||:.:.            :...|.
plant    83 IIDEELGVVQNALERNVKSYGAWYHRKWVLSKKGHYYPSLENELQLLNDYQKQAHQKQDDEKQDD 147

  Fly   179 CASNYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISD-----YSCYHYRQVLLSR--AYELSF 236
            .:.|:|||::|:::::......:.||    ::....|||     ||.:|||.||:|.  |.:...
plant   148 PSRNFHAWNYRRFVVELTKTSEEDEL----QYTTDMISDISFTIYSAWHYRSVLVSSLVAKKADG 208

  Fly   237 ALPKDS 242
            .:||::
plant   209 FMPKET 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 7/38 (18%)
RGTA2NP_001331841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.