DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and RGTA1

DIOPT Version :10

Sequence 1:NP_569992.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_194180.2 Gene:RGTA1 / 828551 AraportID:AT4G24490 Length:678 Species:Arabidopsis thaliana


Alignment Length:170 Identity:51/170 - (30%)
Similarity:86/170 - (50%) Gaps:24/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AQQLRTLQQQQQSDSLAK-YLNVA-------LLINPDVTTFWHIRRQLVQKNRLS---------- 126
            |.|||:||.|..::...| |.|.|       |.|||:..|.|:.|: |..::||:          
plant    21 AVQLRSLQSQFMTNHHDKIYTNEAIELSTKLLEINPEAYTAWNYRK-LAVEDRLARIEPDPNLVS 84

  Fly   127 --INKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADAIDWPNEIGICERAADRCASNYHAWSHR 189
              :::||:.....|....||..|:.:|:|:.|...:..   .||:.:.|:.....:.|:|||::|
plant    85 AILDEELRVVESALRQNFKSYGAWHHRKWVLSKGHSSV---GNELRLLEKFQKLDSRNFHAWNYR 146

  Fly   190 QWILQNGPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLS 229
            :::::......|.||..|:..:..:.|:||.:|.|.||||
plant   147 RFVVELTNRSEQDELQYTDDMINNNFSNYSAWHNRSVLLS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_569992.1 PLN02789 101..>194 CDD:215423 28/111 (25%)
RGTA1NP_194180.2 BET4 25..>234 CDD:227823 48/166 (29%)
PPP1R42 <511..596 CDD:455733
leucine-rich repeat 513..534 CDD:275380
RNA1 <535..670 CDD:444072
leucine-rich repeat 535..556 CDD:275380
leucine-rich repeat 557..581 CDD:275380
leucine-rich repeat 641..666 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.