DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and FTA

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_567084.1 Gene:FTA / 825107 AraportID:AT3G59380 Length:326 Species:Arabidopsis thaliana


Alignment Length:323 Identity:76/323 - (23%)
Similarity:117/323 - (36%) Gaps:95/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QDLASFEIIPKEANCNKSPVVHVEHNLGLESWCAQHVYDHAHRTLISHRRQTTAQQLRTLQQQQQ 91
            |.|...:::|...:...:|||.:.:.   |.:  :...|:......|..|...|  ||..::   
plant    11 QRLEWSDVVPLTQDDGPNPVVPIAYK---EEF--RETMDYFRAIYFSDERSPRA--LRLTEE--- 65

  Fly    92 SDSLAKYLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSALVLSIKPKSNEAFAYRRWLYS 156
                      .||:|....|.||.||.:::.....:.:||:|...:.....|:.:.:.:|||:..
plant    66 ----------TLLLNSGNYTVWHFRRLVLEALNHDLFEELEFIERIAEDNSKNYQLWHHRRWVAE 120

  Fly   157 FQSADAIDWPNEIGICERAADRCASNYHAWSHRQWIL---------------------------- 193
            ....|...  .|:....|.....|.:|||||||||.|                            
plant   121 KLGPDVAG--RELEFTRRVLSLDAKHYHAWSHRQWTLRALGGWEDELDYCHELLEADVFNNSAWN 183

  Fly   194 QNGPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLSRAYELSF----ALPKD------SGASGSS 248
            |....:.||.||...:.||:  |:.| |..:.:|.:.|.|.|:    ||.||      |..|.||
plant   184 QRYYVITQSPLLGGLEAMRE--SEVS-YTIKAILTNPANESSWRYLKALYKDDKESWISDPSVSS 245

  Fly   249 ---------------TLASLQHLMTSYGL----------------ECEANAEDLLGLLLPHVD 280
                           .|::|..|:.. ||                |.|.|..:|:..:|..||
plant   246 VCLNVLSRTDCFHGFALSTLLDLLCD-GLRPTNEHKDSVRALANEEPETNLANLVCTILGRVD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 13/54 (24%)
FTANP_567084.1 PLN02789 4..324 CDD:215423 76/323 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.