DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and rabggta

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001070131.1 Gene:rabggta / 767725 ZFINID:ZDB-GENE-060929-1042 Length:580 Species:Danio rerio


Alignment Length:274 Identity:67/274 - (24%)
Similarity:112/274 - (40%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QTTAQQLRTLQQQQQS---------DSLAKYLNVA-------------LLINPDVTTFWHIRRQL 119
            :|||||....:::::.         ||:.|..:..             |..|||..|.|:.||::
Zfish     8 KTTAQQEEEKRKEREKKLKAFVCARDSVLKKRSAGEHDEEALDLTQQLLSSNPDFATLWNYRREV 72

  Fly   120 V-------QKNRLS--INKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADAIDWPNEIGICERA 175
            :       :|:.:.  ...||.|....|.:.|||...:.:|.|:.:  .....||..|:|:|   
Zfish    73 LLHLETLREKDEVQKLYESELHFIEACLKVNPKSYGCWHHRSWVNT--RLPQPDWTRELGLC--- 132

  Fly   176 ADRCAS----NYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLSR------ 230
             |||.|    |:|.|.:|:.:::.....::.||..|::.:..:.|:||.:|||..||.:      
Zfish   133 -DRCLSLDERNFHCWDYRRLVVKESGVSVEQELQFTDRLIGSNFSNYSSWHYRSTLLPQLRPQPV 196

  Fly   231 ---AYELSFALPKDSGASGSSTLASLQHLMTSYGLECEANAED------------LLGLLLPHVD 280
               |:..| ..|..|..|.|..:.. :.|:..|.|...|...|            |||       
Zfish   197 LDSAHNTS-PSPSASPQSHSHRVCE-EQLLKEYELAHNAFFTDPNDQSAWFYYRWLLG------- 252

  Fly   281 LSSVSKQRLISFLY 294
              ...::.:||.:|
Zfish   253 --RAEREEMISCVY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 11/30 (37%)
rabggtaNP_001070131.1 BET4 38..>252 CDD:227823 54/221 (24%)
PPTA 92..116 CDD:279565 8/23 (35%)
PPTA 128..154 CDD:279565 11/29 (38%)
PPTA 163..190 CDD:279565 11/26 (42%)
PPTA 226..253 CDD:279565 7/35 (20%)
RabGGT_insert 260..359 CDD:285012 3/5 (60%)
LRR_RI 325..580 CDD:238064
leucine-rich repeat 456..474 CDD:275378
leucine-rich repeat 475..500 CDD:275378
LRR_8 478..533 CDD:290566
leucine-rich repeat 501..522 CDD:275378
leucine-rich repeat 523..547 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.