DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and rabggta

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001006728.1 Gene:rabggta / 448385 XenbaseID:XB-GENE-1004892 Length:565 Species:Xenopus tropicalis


Alignment Length:170 Identity:49/170 - (28%)
Similarity:80/170 - (47%) Gaps:25/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HRRQTTAQQLRTLQQQQQSDSLAKYLNVALL-INPDVTTFWHIRRQL---VQKNR-------LSI 127
            |:|:|           .|.|..|..|...:| :|||..:.|::||::   :|.:|       |.:
 Frog    37 HKRET-----------GQLDKEALDLTAQILALNPDFASLWNLRREVFLQLQTDRSEEEMQSLCL 90

  Fly   128 NKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADAIDWPNEIGICERAADRCASNYHAWSHRQWI 192
            . ||.|....|.:.|||...:.:|.|:  .:.....||..|:.:|.|..:....|:|.|.:|:.:
 Frog    91 G-ELTFLENCLRVSPKSYGTWYHRCWI--MKIIPKPDWARELTLCNRFLEIDERNFHCWDYRRIV 152

  Fly   193 LQNGPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLSRAY 232
            .|:....|..||..|...:.|:.|:||.:|||..||.:.:
 Frog   153 TQSSSVPLPEELEFTTSLIGKNFSNYSSWHYRSKLLPQIH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 7/26 (27%)
rabggtaNP_001006728.1 BET4 1..>239 CDD:227823 49/170 (29%)
RabGGT_insert 243..336 CDD:369477
LRR_9 454..557 CDD:373143
leucine-rich repeat 460..482 CDD:275378
leucine-rich repeat 483..504 CDD:275378
leucine-rich repeat 505..529 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.