DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and PTAR1

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001353865.1 Gene:PTAR1 / 375743 HGNCID:30449 Length:429 Species:Homo sapiens


Alignment Length:302 Identity:94/302 - (31%)
Similarity:142/302 - (47%) Gaps:55/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEERNEKKVLCEKIIRDINAVFLKDQDLASFEIIP-KEANCNKSPVVHVEHNLGLESWCAQHVY 64
            |.|...|..||.:::::||...|.::..:....:|| .||..|:||:|.||:.||:||||.:.:.
Human     1 MAETSEEVAVLVQRVVKDITNAFRRNPHIDEIGLIPCPEARYNRSPIVLVENKLGVESWCVKFLL 65

  Fly    65 DHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAKYLNVALLINPDVTTFWHIRRQLVQKNRLSINK 129
            .:.|..|:.:         ||.:|....|.|.......||:|||.||.|::|::|:....|:..|
Human    66 PYVHNKLLLY---------RTRKQWLNRDELIDVTCTLLLLNPDFTTAWNVRKELILSGTLNPIK 121

  Fly   130 ELQFSALVLSIKPKSNEAFAYRRWLYSFQSADAIDWPN---------------------EIGICE 173
            :|....|.|:..|||.|.:.:|||:.. |.......|:                     |:.:|.
Human   122 DLHLGKLALTKFPKSPETWIHRRWVLQ-QLIQETSLPSFVTKGNLGTIPTERAQRLIQEEMEVCG 185

  Fly   174 RAADRCASNYHAWSHRQWILQN----GPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLSRAY-- 232
            .||.|..|||:|||||.|:||:    ...:|..||..|:.:...|:||:|.:||||.||....  
Human   186 EAAGRYPSNYNAWSHRIWVLQHLAKLDVKILLDELSSTKHWASMHVSDHSGFHYRQFLLKSLISQ 250

  Fly   233 ---------------ELSFALPKDSGASGSS--TLASLQHLM 257
                           |.:...|||..|:.|:  ...:|.||:
Human   251 TVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 15/26 (58%)
PTAR1NP_001353865.1 PPTA 82..>208 CDD:332411 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141975
Domainoid 1 1.000 79 1.000 Domainoid score I8720
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 1 1.000 - - FOG0007269
OrthoInspector 1 1.000 - - oto89827
orthoMCL 1 0.900 - - OOG6_104942
Panther 1 1.100 - - LDO PTHR11129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5857
SonicParanoid 1 1.000 - - X5374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.