DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and Fnta

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_036979.2 Gene:Fnta / 25318 RGDID:2625 Length:377 Species:Rattus norvegicus


Alignment Length:336 Identity:76/336 - (22%)
Similarity:131/336 - (38%) Gaps:84/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EIIPKEANCNKSPVVHVEHNLGLESWCAQHVYDHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAK 97
            :|.|...|...||||.:             :|....|.:..:.|       ..||:.::|:...|
  Rat    74 DIDPVPQNDGPSPVVQI-------------IYSEKFRDVYDYFR-------AVLQRDERSERAFK 118

  Fly    98 YLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADA 162
            ....|:.:|....|.||.||.|::..:..:.:|:.:...::..:||:.:.:.:||.|        
  Rat   119 LTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVL-------- 175

  Fly   163 IDW----PNEIGICERAADRCASNYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISDYSCYHY 223
            ::|    ..|:.......::.|.|||||.||||::|... |..:||...::.:::.:.:.|.::.
  Rat   176 VEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFR-LWDNELQYVDQLLKEDVRNNSVWNQ 239

  Fly   224 RQVLLS-------RAY---ELSFAL------PKDSGASGSSTLASLQHLMTSYGLECEANAEDLL 272
            |..::|       ||.   |:.:.|      |.:..|..     .|:.::...||....|   ||
  Rat   240 RHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWN-----YLKGILQDRGLSRYPN---LL 296

  Fly   273 GLLLPHVDLS-SVSKQRLISFL----------YC-------------CNVAANDMRLCAEQRLMY 313
            ..||   ||. |.|...||:||          .|             |.:.|.:.....::...|
  Rat   297 NQLL---DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRY 358

  Fly   314 GSRDCFELHRR 324
            ..|.....|.|
  Rat   359 IGRSLQSKHSR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 11/26 (42%)
FntaNP_036979.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
PLN02789 64..365 CDD:215423 74/330 (22%)
PFTA 1 112..146 10/33 (30%)
PFTA 2 147..181 7/41 (17%)
PFTA 3 182..214 12/31 (39%)
PFTA 4 215..249 6/33 (18%)
PFTA 5 255..289 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.