DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and FNTA

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_002018.1 Gene:FNTA / 2339 HGNCID:3782 Length:379 Species:Homo sapiens


Alignment Length:282 Identity:68/282 - (24%)
Similarity:121/282 - (42%) Gaps:61/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EIIPKEANCNKSPVVHVEHNLGLESWCAQHVYDHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAK 97
            :|.|...|...:|||.:             :|....|.:..:.|       ..||:.::|:...|
Human    74 DIDPVPQNDGPNPVVQI-------------IYSDKFRDVYDYFR-------AVLQRDERSERAFK 118

  Fly    98 YLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADA 162
            ....|:.:|....|.||.||.|::..:..:::|:.:...::..:||:.:.:.:||.|        
Human   119 LTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVL-------- 175

  Fly   163 IDW----PNEIGICERAADRCASNYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISDYSCYHY 223
            ::|    ..|:.......::.|.|||||.||||::|... |..:||...::.:::.:.:.|.::.
Human   176 VEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFK-LWDNELQYVDQLLKEDVRNNSVWNQ 239

  Fly   224 RQVLLS-------RAY---ELSFAL------PKDSGASGSSTLASLQHLMTSYGLECEANAEDLL 272
            |..::|       ||.   |:.:.|      |.:..|..     .|:.::...||....|   ||
Human   240 RYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWN-----YLKGILQDRGLSKYPN---LL 296

  Fly   273 GLLLPHVDLS-SVSKQRLISFL 293
            ..||   ||. |.|...||:||
Human   297 NQLL---DLQPSHSSPYLIAFL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 11/26 (42%)
FNTANP_002018.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
PLN02789 64..365 CDD:215423 68/282 (24%)
PFTA 1 112..146 10/33 (30%)
PFTA 2 147..180 7/40 (18%)
PFTA 3 181..215 12/34 (35%)
PFTA 4 216..249 5/32 (16%)
PFTA 5 255..289 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1452
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.