DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and M57.2

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_500367.1 Gene:M57.2 / 177113 WormBaseID:WBGene00019778 Length:580 Species:Caenorhabditis elegans


Alignment Length:208 Identity:54/208 - (25%)
Similarity:91/208 - (43%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QQQQQSDSLAKYLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSA---------------- 135
            ::.:..|.:.......|..|.|:.|||:|||..::. |:..|:::|.||                
 Worm    40 EKGEYDDEILSLTQAILEKNADIYTFWNIRRTTIEL-RMEANEKVQQSADAEEEEKTKSSQKIEN 103

  Fly   136 -----LVLSIK-----PKSNEAFAYRRWLYSFQSADAIDWPNEIGICERAADRCASNYHAWSHRQ 190
                 |.||.:     |||..|:..|.|....|||.  |:..|:.:||:|......|:|.|.||:
 Worm   104 LLAGELFLSYECIKSNPKSYSAWYQRAWALQRQSAP--DFKKELALCEKALQLDCRNFHCWDHRR 166

  Fly   191 WILQNGPCLLQSELLRTEKFMRKHISDYSCYHYRQVLLSRAYELSFALPKDSGAS--GSSTLAS- 252
            .:.:........||..:.|.:..:.|:||.:|||.:.|...:.     .:.:||.  ....:|| 
 Worm   167 IVARMAKRSEAEELEFSNKLINDNFSNYSAWHYRSIALKNIHR-----DEKTGAPKIDDELIASE 226

  Fly   253 LQHLMTSYGLECE 265
            ||.:..::.::.|
 Worm   227 LQKVKNAFFMDAE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 9/26 (35%)
M57.2NP_500367.1 BET4 37..>264 CDD:227823 54/208 (26%)
PPTA 108..135 CDD:279565 9/26 (35%)
TPR repeat 123..153 CDD:276809 11/31 (35%)
PPTA 144..168 CDD:279565 9/23 (39%)
TPR repeat 158..189 CDD:276809 8/30 (27%)
PPTA 179..206 CDD:279565 10/26 (38%)
PPTA 226..252 CDD:279565 3/14 (21%)
LRR 405..>550 CDD:227223
LRR_4 499..539 CDD:289563
leucine-rich repeat 501..522 CDD:275378
leucine-rich repeat 523..548 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.