DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment temp and Fnta

DIOPT Version :9

Sequence 1:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_032059.1 Gene:Fnta / 14272 MGIID:104683 Length:377 Species:Mus musculus


Alignment Length:282 Identity:68/282 - (24%)
Similarity:119/282 - (42%) Gaps:61/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EIIPKEANCNKSPVVHVEHNLGLESWCAQHVYDHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAK 97
            :|.|...|...:|||.:             :|....|.:..:.|       ..||:.::|:...|
Mouse    74 DIDPVPQNDGPNPVVQI-------------IYSEKFRDVYDYFR-------AVLQRDERSERAFK 118

  Fly    98 YLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADA 162
            ....|:.:|....|.||.||.|::..:..:.:|:.:...::..:||:.:.:.:||.|        
Mouse   119 LTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVL-------- 175

  Fly   163 IDW----PNEIGICERAADRCASNYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISDYSCYHY 223
            ::|    ..|:........:.|.|||||.||||::|... |..:||...::.:::.:.:.|.::.
Mouse   176 VEWLKDPSQELEFIADILSQDAKNYHAWQHRQWVIQEFR-LWDNELQYVDQLLKEDVRNNSVWNQ 239

  Fly   224 RQVLLS-------RAY---ELSFAL------PKDSGASGSSTLASLQHLMTSYGLECEANAEDLL 272
            |..::|       ||.   |:.:.|      |.:..|..     .|:.::...||....|   ||
Mouse   240 RHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWN-----YLKGILQDRGLSRYPN---LL 296

  Fly   273 GLLLPHVDLS-SVSKQRLISFL 293
            ..||   ||. |.|...||:||
Mouse   297 NQLL---DLQPSHSSPYLIAFL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tempNP_001284818.1 PPTA 168..195 CDD:279565 11/26 (42%)
FntaNP_032059.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
PPTA 64..365 CDD:332411 68/282 (24%)
PFTA 1 112..146 10/33 (30%)
PFTA 2 147..181 7/41 (17%)
PFTA 3 182..214 12/31 (39%)
PFTA 4 215..249 6/33 (18%)
PFTA 5 255..289 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1452
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.