DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and SEC14L5

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:331 Identity:63/331 - (19%)
Similarity:116/331 - (35%) Gaps:72/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKDTGDKDSAPETSASPATGWSDKLTDLVAWF-EANPNLPEKIEPIVMLRFLKCTAFDVERTKA 64
            ||.|..|.|................|..|..|. |.:.....|.|.|  ||||:...|.:::.:.
Human   221 MDGDKLDADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKDEHI--LRFLRAHDFHLDKARE 283

  Fly    65 LAELNYCMRN-----------KSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMA 118
            :...:...|.           :.|.|.      :|..|.|....|:        .|..|...|:.
Human   284 MLRQSLSWRKQHQVDLLLQTWQPPALL------EEFYAGGWHYQDI--------DGRPLYILRLG 334

  Fly   119 DLDPR--TRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQ----------- 170
            .:|.:  .:...||..:..::|         ..|.|...         .||..:           
Human   335 QMDTKGLMKAVGEEALLRHVLS---------VNEEGQKR---------CEGSTRQLGRPISSWTC 381

  Fly   171 IVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNM 235
            ::|:.|..:|||....:..|...::.:::.||..|..:.::..|.....|.:::|||:.|..|..
Human   382 LLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRK 446

  Fly   236 IRYHT----EGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRDNAAYLSDERYWKVAAQS 296
            ...::    :|...|...:.|:::|:..||:  :|..:...|:.   ..:.|:::|.    ...:
Human   447 FLIYSGSNYQGPGGLVDYLDREVIPDFLGGE--SVCNVPEGGLV---PKSLYMTEEE----QEHT 502

  Fly   297 KSRWSW 302
            ...|.|
Human   503 DQLWQW 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 32/177 (18%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 12/46 (26%)
SEC14 306..479 CDD:214706 39/206 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.