DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and SFH5

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:20/76 - (26%)
Similarity:34/76 - (44%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 VLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEG--MDSLYKEVP 251
            |:.::.|:    ||..|.|.:.:|.||....:..::..|:.|..|......|:|  :....|:.|
Yeast   194 VIGIFQKY----YPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYLKDCP 254

  Fly   252 RDMLPNEYGGK 262
            .:    .||||
Yeast   255 YE----GYGGK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 18/74 (24%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.