DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and AT1G22180

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001322892.1 Gene:AT1G22180 / 838823 AraportID:AT1G22180 Length:314 Species:Arabidopsis thaliana


Alignment Length:147 Identity:37/147 - (25%)
Similarity:63/147 - (42%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLIS 222
            :|:..|..|..|.::|..|:.:.|   :|:.|.|.....|||.||.||....|.|.|...:....
plant   137 ILNLPDNQEQMVWLIDFHGFNMSH---ISLKVSRETAHVLQEHYPERLGLAIVYNPPKIFESFYK 198

  Fly   223 MMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNE-----YGGKAGTVA-------------EL 269
            |:.|||..:..|.::: ....|:|..::..|:...|     :|||.....             :|
plant   199 MVKPFLEPKTSNKVKF-VYSDDNLSNKLLEDLFDMEQLEVAFGGKNSDAGFNFEKYAERMREDDL 262

  Fly   270 KAKGIQSIRDNAAYLSD 286
            |..|..::...:|:|::
plant   263 KFYGNTTVSSTSAHLTN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 30/108 (28%)
AT1G22180NP_001322892.1 CRAL_TRIO_N 25..70 CDD:215024
SEC14 90..243 CDD:214706 31/109 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.