DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and AT4G08690

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001031598.1 Gene:AT4G08690 / 826436 AraportID:AT4G08690 Length:301 Species:Arabidopsis thaliana


Alignment Length:245 Identity:58/245 - (23%)
Similarity:97/245 - (39%) Gaps:61/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPEKIEPI----VMLRFLKCTAFDVER-TKALAE-LNYCMRNKSPHLFMDRNMEDEMTAEGLRVS 97
            ||||:...    .:||:|:...:.|:: ||.|.| |.:.::.|...:..:....:..|.:..|.|
plant    33 LPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQYKPEEICWEEVAGEAETGKIYRSS 97

  Fly    98 DLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEA 162
                  .|...|..::..         |.|||.:|  .:....|:..            |.::.|
plant    98 ------CVDKLGRPVLIM---------RPSVENSK--SVKGQIRYLV------------YCMENA 133

  Fly   163 --DIAEGDVQIV---DIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLIS 222
              ::..|:.|:|   |..||:   ||.||:...:.....|||.||.||....:.|.|.:.:....
plant   134 VQNLPPGEEQMVWMIDFHGYS---LANVSLRTTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWK 195

  Fly   223 MMSPFLREEVRNMIRYHTEGMDSLYKEVPR---------DMLPNE--YGG 261
            :..|||..:.||.:::       :|.:.|.         ||...|  :||
plant   196 VARPFLEPKTRNKVKF-------VYSDDPNTKVIMEENFDMEKMELAFGG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 41/177 (23%)
AT4G08690NP_001031598.1 CRAL_TRIO_N 20..67 CDD:215024 11/33 (33%)
SEC14 87..241 CDD:214706 44/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.