DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and TTPAL

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001034288.1 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens


Alignment Length:262 Identity:65/262 - (24%)
Similarity:113/262 - (43%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMT 90
            |.|:|.  :..|||...::...:||||:...||.:|...|....:..|...|.:|  .|::....
Human    61 LRDMVR--KEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVF--NNLKPSAL 121

  Fly    91 AEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGA 155
            .:.|....|.:||...|:|..::..|.....|......|..:...:..:                
Human   122 KDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLE---------------- 170

  Fly   156 DYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKL 220
            ..:..|.....|.|.:.|..|.:|...::...|:.:..:..||:.:|.|::|:||:|.|.....:
Human   171 KLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGI 235

  Fly   221 ISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRDNAAYLS 285
            .:::.|||:|::.|....|...::||:..:||.:||.||||.||.        :.:...||..|:
Human   236 FAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGE--------LDTATWNAVLLA 292

  Fly   286 DE 287
            .|
Human   293 SE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 38/160 (24%)
TTPALNP_001034288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CRAL_TRIO_N 56..102 CDD:215024 14/42 (33%)
SEC14 121..277 CDD:238099 40/171 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.