DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:353 Identity:63/353 - (17%)
Similarity:120/353 - (33%) Gaps:108/353 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKDTGDKDSAPETSASPATGWSDKLTD---------------------LVAWF-EANPNLPEKI 43
            |:..:|:..|:|.|::.|..|..|...|                     |..|. |.:.....|.
Mouse   213 MEGLSGENLSSPGTASEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKD 277

  Fly    44 EPIVMLRFLKCTAFDVERTKALA----------ELNYCMRN-KSPHLFMDRNMEDEMTAEGLRVS 97
            |.|  ||||:...|::::.:.:.          :::|.:.. ..|.:.:|      ..|.|....
Mouse   278 EHI--LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLD------YYAGGWHHH 334

  Fly    98 DLLILPGVTPQGNKLIFFRMADLDPR----------------------TRNSVEETKIFVMMSDA 140
            |        ..|..|...|:..:|.:                      .|...|.||:|      
Mouse   335 D--------KDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVF------ 385

  Fly   141 RFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRL 205
                   .|...|.              ..:||:.|..:|||....:..|...::.::..||..|
Mouse   386 -------GRPISSW--------------TCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETL 429

  Fly   206 QAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHT----EGMDSLYKEVPRDMLPNEYGGKAGTV 266
            ..:.::..|.....|.:::|||:.:..|.....:.    :|...|...:.::::|:...|:.  :
Mouse   430 GRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGEC--M 492

  Fly   267 AELKAKGI--QSIRDNAAYLSDE--RYW 290
            .::...|:  :|:...|..|.:|  :.|
Mouse   493 CDVPEGGLVPKSLYRTAEELENEDLKLW 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 30/186 (16%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 59/341 (17%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 11/46 (24%)
CRAL_TRIO 326..490 CDD:279044 33/198 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.