DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:260 Identity:54/260 - (20%)
Similarity:99/260 - (38%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SDKLTDLVAWFEAN-----PNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMD 82
            |.|..:.:|.|..|     |.||.. :...:||:|:..:||:::::|       |..|.......
Mouse     9 SPKQEEALAKFRENVQDVLPTLPNP-DDYFLLRWLRARSFDLQKSEA-------MLRKHVEFRKQ 65

  Fly    83 RNMEDEMTAEGLRVSDLLILPG---------------VTPQGNKLIFFRMADLDPRTRNSVEETK 132
            ::::..::.:...|....:..|               :.|...|.:.|..:..| ..|..:.:.:
Mouse    66 KDIDKIISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQD-LLRTKMRDCE 129

  Fly   133 IFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFL 197
            :.:.....:.||...:.||                ...|.|..|..|:||...::.....::...
Mouse   130 LLLQECIQQTTKLGKKIET----------------ITMIYDCEGLGLKHLWKPAVEAYGEFLTMF 178

  Fly   198 QEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIR-YHTEGMDSLYKEVPRDMLPNEYGG 261
            :|.||..|:.:.|:..|.......:::.|||.|:.|..|. ......:.|.|.:..|.||.||||
Mouse   179 EENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGG 243

  Fly   262  261
            Mouse   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 37/177 (21%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 13/53 (25%)
SEC14 76..244 CDD:214706 38/185 (21%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.