DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and SEC14L1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001034662.3 Gene:SEC14L1 / 6397 HGNCID:10698 Length:719 Species:Homo sapiens


Alignment Length:348 Identity:62/348 - (17%)
Similarity:117/348 - (33%) Gaps:107/348 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGDKDSAPETSASPATGWSDKLTD---------------------LVAWF-EANPNLPEKIEPIV 47
            :||..|:| ::..|..|..|...|                     |..|. |.:.....|.|.| 
Human   218 SGDALSSP-SAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI- 280

  Fly    48 MLRFLKCTAFDVERTKALA----------ELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLIL 102
             ||||:...|::::.:.:.          :::|.:...:|...:     .:..|.|....|    
Human   281 -LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVL-----QDYYAGGWHHHD---- 335

  Fly   103 PGVTPQGNKLIFFRMADLDPR----------------------TRNSVEETKIFVMMSDARFTKP 145
                ..|..|...|:..:|.:                      .|...|.||:|           
Human   336 ----KDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVF----------- 385

  Fly   146 DVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHV 210
              .|...|.              ..:||:.|..:|||....:..|...::.::..||..|..:.:
Human   386 --GRPISSW--------------TCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLI 434

  Fly   211 INCPTYLDKLISMMSPFLREEVRNMIRYHT----EGMDSLYKEVPRDMLPNEYGGKAGTVAELKA 271
            :..|.....|.:::|||:.:..|.....:.    :|...|...:.::::|:...|:.  :.|:..
Human   435 LRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGEC--MCEVPE 497

  Fly   272 KGI--QSIRDNAAYLSDE--RYW 290
            .|:  :|:...|..|.:|  :.|
Human   498 GGLVPKSLYRTAEELENEDLKLW 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 30/186 (16%)
SEC14L1NP_001034662.3 PRELI 17..173 CDD:368069
CRAL_TRIO_N 256..301 CDD:215024 11/46 (24%)
CRAL_TRIO 326..490 CDD:366224 33/198 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.