DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and RLBP1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:248 Identity:60/248 - (24%)
Similarity:113/248 - (45%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQ----G 109
            |||::...|:|.|...|.......|.:.|.||      |.::.|.:|.:.....|||...    |
Human   106 LRFIRARKFNVGRAYELLRGYVNFRLQYPELF------DSLSPEAVRCTIEAGYPGVLSSRDKYG 164

  Fly   110 NKLIFFRMADLDPR--TRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIV 172
            ..::.|.:.:...:  |.:.:.:...|::       :..:|.|          |..| .|...|.
Human   165 RVVMLFNIENWQSQEITFDEILQAYCFIL-------EKLLENE----------ETQI-NGFCIIE 211

  Fly   173 DIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIR 237
            :..|:|::..|.:....||..:..||:::|:|.:|:|.|:.|.|.....:::.|||:.::...:.
Human   212 NFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVF 276

  Fly   238 YHTEGMDSLYKEVPRDMLPNEYG-------GKAGTVAELKAKGIQSIRDNAAY 283
            .|.:.:...|:|:..::||:::|       |||  ||| :..|.|:..:|.|:
Human   277 VHGDDLSGFYQEIDENILPSDFGGTLPKYDGKA--VAE-QLFGPQAQAENTAF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 36/173 (21%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.