DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:269 Identity:61/269 - (22%)
Similarity:118/269 - (43%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DSAPETSASPATGWSDKLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMR 73
            |.:|:...: .|.:.:.|.|::      |.|| |.:...:||:|:...||:::::.:...:...|
  Rat     7 DLSPQQQEA-LTRFREILQDVL------PTLP-KADDFFLLRWLRARNFDLKKSEDMLRKHVEFR 63

  Fly    74 NKSPHLFMDRNMEDEMT---AEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFV 135
            |:       ::::..:|   .|.:|:.|...|.|...:|..:.|..:..|||:        .:|:
  Rat    64 NQ-------QDLDHILTWQPPEVIRLYDSGGLCGYDYEGCPVWFDLIGTLDPK--------GLFM 113

  Fly   136 MMSDARFTKPDVERETGSGADYVLDEADI--------AEGDVQIVDIGGYTLRHLAYVSIFVLRV 192
            ..|     |.|:.|:.....:.:|.|.::        .|..|.:.|:.|.:||||...::.|.:.
  Rat   114 SAS-----KQDLIRKRIKVCEMLLHECELQSQKLGRKVERMVMVFDMEGLSLRHLWKPAVEVYQQ 173

  Fly   193 YMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMI-----RYHTEGMDSLYKEVPR 252
            :...|:..||..::.:.||..|.......:::..|:.|..:..|     .:..|    |.|.:..
  Rat   174 FFAILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQE----LLKFMSP 234

  Fly   253 DMLPNEYGG 261
            |.||.|:||
  Rat   235 DQLPVEFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 41/174 (24%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 12/53 (23%)
SEC14 76..244 CDD:214706 44/185 (24%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.