DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG10301

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster


Alignment Length:263 Identity:50/263 - (19%)
Similarity:102/263 - (38%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEG 93
            |..|....|:|..:.:...::.||:...:.:|.||...:..:...|..|.:..:|.:...:.  .
  Fly    31 LRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRIDRYFTHYNLFPEIMNNRCVTQRLL--D 93

  Fly    94 LRVSDLLILPGVTPQGNK---LIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGA 155
            :....:.:.|.: |:|:.   :...|....||         .::::.....|:...:|       
  Fly    94 INRMGVCLYPDM-PKGDSRSAMFIARFGHFDP---------NLYMLREIYHFSSMAME------- 141

  Fly   156 DYVLDEADIAE--GDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLD 218
             .:..|.|.|.  |..:|:|:.|.....:......:.|.:..:|....|.:::.|::||.|..:.
  Fly   142 -VIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYIINMPKDIQ 205

  Fly   219 KLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRDNAAY 283
            ..:..:...|..:|...||. .:..:.|.:.:.::.||.||||..|.:.|.           .||
  Fly   206 GTVMFLYNVLSMQVNYPIRV-LKNSEELIEHIGKESLPEEYGGTNGHLGEC-----------VAY 258

  Fly   284 LSD 286
            :.|
  Fly   259 MED 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 32/165 (19%)
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 9/39 (23%)
CRAL_TRIO 114..248 CDD:279044 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.