DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and rlbp1a

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_956999.1 Gene:rlbp1a / 393678 ZFINID:ZDB-GENE-040426-1662 Length:312 Species:Danio rerio


Alignment Length:265 Identity:53/265 - (20%)
Similarity:109/265 - (41%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDSAPETSASPATGWSDKLTDLVAWFEANPNLPEKI----------EP-IVMLRFLKCTAFDVER 61
            ||...||....|:.    :.:|.|..:......:::          || .::|||::...|||.|
Zfish    48 KDELNETDEKRASA----IKELRAMIKDKAGQGDEVAKTVQDKFGKEPDSLLLRFIRARKFDVAR 108

  Fly    62 TKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRN 126
            ...|.:.....|...|.||  .|:..|.....:......||......|..::.|.:.:.|.....
Zfish   109 AHELMKGYVRFRRDYPELF--ENLTPEAVRSTIEAGYPRILSTRDKNGRVVLLFNIDNWDLEEVT 171

  Fly   127 SVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLR 191
            ..|..:.:.::.:......:.:                ..|.|.|.:..|:|::|.:.:....|:
Zfish   172 FDETLRAYCVILEKLLENEETQ----------------INGFVLIENFKGFTMQHASGIKHTELK 220

  Fly   192 VYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLP 256
            ..:..||:::|:|.:|:|||:.|.|.....:::.||::.::...:..|.:.:|...::...::||
Zfish   221 KMVDMLQDSFPARFKAVHVIHQPWYFTTTYNVVKPFMKSKLLERVFVHGDELDGYLRDFGAEILP 285

  Fly   257 NEYGG 261
            .::.|
Zfish   286 PDFDG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 30/161 (19%)
rlbp1aNP_956999.1 CRAL_TRIO_N 59..116 CDD:215024 13/60 (22%)
CRAL_TRIO 142..291 CDD:279044 30/165 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.