DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG33965

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:301 Identity:67/301 - (22%)
Similarity:132/301 - (43%) Gaps:35/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDSAPETSASPATGWSDKLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCM 72
            |.:..|.:..|:...|| :..|..|.:..|:|...:|...:|.||:.:.|.:|:.|...:..|.:
  Fly    18 KVAIEELNEVPSRVESD-IAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSL 81

  Fly    73 RNKSPHLFMDRNMEDE-MTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFVM 136
            :...|.:|.|:.:.|. ...|.:|:..:|.:|                ||.      |:|...|.
  Fly    82 QAVIPEVFNDQRLVDNAQVLEIIRLGVILRIP----------------LDE------EDTGPAVT 124

  Fly   137 MSDA------RFTKPDVERETGSGADYVLDEADIA--EGDVQIVDIGGYTLRHLAYVSIFVLRVY 193
            :..|      :|...|:.|......:.::.|.|.|  .|.::|:|:.|.|..:|..:...:|..:
  Fly   125 IIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKF 189

  Fly   194 MKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNE 258
            ..:..||.|:|.:.:|.||.|...:.....:..:...:::..:...:: .:::::.||:..||.|
  Fly   190 SAYADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSVSSD-PEAIFERVPKHYLPEE 253

  Fly   259 YGGKAGTVAELKAKGIQSIRDNAAYLSDERYWKVAAQSKSR 299
            |||..||:.::..:....:....:|..|.:::  .|..|.|
  Fly   254 YGGSKGTMKDITDQMEAKLCSYRSYFEDCQHF--GAHDKLR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 35/168 (21%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/45 (29%)
SEC14 101..256 CDD:238099 37/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.