DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG32485

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:183 Identity:37/183 - (20%)
Similarity:69/183 - (37%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 MDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNS----VEETKIFVMMSDAR 141
            |||:..|: .|..||..|.:        |..:|:.      |...:|    ::|...|::.:...
  Fly    73 MDRSQLDK-KARLLRHRDCI--------GRPVIYI------PAKNHSSERDIDELTRFIVYNLEE 122

  Fly   142 FTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTL-RHLAYVSIFVLRVYMKFLQEAYPSRL 205
            ..|...|..|    |.:....|:||.....:|   |.| ::|.::           |.:.:|.||
  Fly   123 ACKKCFEEVT----DRLCIVFDLAEFSTSCMD---YQLVQNLIWL-----------LGKHFPERL 169

  Fly   206 QAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNE 258
            ....:||.|.....:...:...|.:.....:::..:..:.....:| |:||.:
  Fly   170 GVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIP-DILPTD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 29/163 (18%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/166 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.