DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:274 Identity:59/274 - (21%)
Similarity:104/274 - (37%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SDKLTDLVAWFEAN-----PNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMD 82
            |.|..:.:|.|..|     |.||.. :...:||:|:...||:::::|:               :.
Mouse     9 SPKQAETLAKFRENVQDVLPALPNP-DDYFLLRWLRARNFDLQKSEAM---------------LR 57

  Fly    83 RNMEDEMTAEGLRVSDLL----------ILP----GVTPQGNKLIFFRMADLDPR------TRNS 127
            :.||...|.:   :..:|          .:|    |....|..:.:..:..|||:      |:..
Mouse    58 KYMEFRKTMD---IDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQD 119

  Fly   128 VEETKIFVMMSDARFTKPDVERETGSGADYVLDEADI--------AEGDVQIVDIGGYTLRHLAY 184
            :.:||:           .|.||        :|.|.|:        .|..|.|.|..|..|:|...
Mouse   120 LLKTKM-----------RDCER--------ILHECDLQTERLGRKIETIVMIFDCEGLGLKHFWK 165

  Fly   185 VSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRN--MIRYHTEGMDSLY 247
            ..:.|.:.:...|:|.||..|:.|.::..........::|.|||.|:.|.  ::.......:.|.
Mouse   166 PLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLL 230

  Fly   248 KEVPRDMLPNEYGG 261
            |.:..:.||..:||
Mouse   231 KLISPEELPAHFGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 41/181 (23%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 12/61 (20%)
SEC14 76..246 CDD:214706 41/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.