DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:316 Identity:56/316 - (17%)
Similarity:103/316 - (32%) Gaps:100/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGDKDSAPETSASPATGWSDKLTD---------------------LVAWF-EANPNLPEKIEPIV 47
            :|:..|:|.|.|.|..|..|...|                     |..|. |.:.....|.|.| 
  Rat   218 SGEVLSSPGTVAEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI- 281

  Fly    48 MLRFLKCTAFDVERTKALA----------ELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLIL 102
             ||||:...|::::.:.:.          :::|.:...:|...:     .:..|.|....|    
  Rat   282 -LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVL-----QDYYAGGWHHHD---- 336

  Fly   103 PGVTPQGNKLIFFRMADLDPR----------------------TRNSVEETKIFVMMSDARFTKP 145
                ..|..|...|:..:|.:                      .|...|.||:|           
  Rat   337 ----KDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVF----------- 386

  Fly   146 DVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHV 210
              .|...|.              ..:||:.|..:|||....:..|...::.::..||..|..:.:
  Rat   387 --GRPISSW--------------TCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLI 435

  Fly   211 INCPTYLDKLISMMSPFLREEVRNMIRYHT----EGMDSLYKEVPRDMLPNEYGGK 262
            :..|.....|.:::|||:.:..|.....:.    :|...|...:.::::|:...|:
  Rat   436 LRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 30/186 (16%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 11/46 (24%)
CRAL_TRIO 327..491 CDD:279044 33/198 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.