DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG12926

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:287 Identity:69/287 - (24%)
Similarity:133/287 - (46%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DKLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDE 88
            :.:..|..|....|:|..:.:...::.||:...:.:|:||...:..|.||...|.|:.:|.:.::
  Fly    33 EDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEK 97

  Fly    89 MTAEGLRVSD---LLILP-GVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVER 149
            .    |.:.|   ||.|| .:...|.::...|....|.:..:..|..::..|:.:.:.      |
  Fly    98 Q----LSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEVVQVNTMLGEIQI------R 152

  Fly   150 ETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCP 214
            |         |:..:..|.|:|:|:.|....||......:::.......:|||.|.:..|.:|.|
  Fly   153 E---------DDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAP 208

  Fly   215 TYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSI-- 277
            :..:|.:|:....:.|::|.....|:: :|||||.||::.||.||||..||:.::.:.....:  
  Fly   209 SSAEKFMSIAKSLMSEKIRKRFHIHSK-LDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLLA 272

  Fly   278 -----RDNAAYLSDERYWK---VAAQS 296
                 .:.|:|.::|:..:   |:|:|
  Fly   273 YKPFFEEEASYGTNEKLRRGQPVSAES 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 41/161 (25%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 9/43 (21%)
SEC14 117..254 CDD:238099 38/152 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.