DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG10026

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:259 Identity:67/259 - (25%)
Similarity:109/259 - (42%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 APETSASPATGWSDKLTDLVAWF--EANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMR 73
            |.|....|::  .||:.:....:  |.|...|.:.:...:.:||:...:.:|.:..|....|..|
  Fly    32 AQEQGECPSS--KDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFR 94

  Fly    74 --NKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTP----QGNKLIFFRMADLDPRTRNSVEETK 132
              |||   |.::....::...|  .||:|.   |||    .|::::.:|.....|   |.|....
  Fly    95 EQNKS---FYEKVRPLDLRHVG--QSDILT---VTPYRDQHGHRILIYRFGLWRP---NQVTVDD 148

  Fly   133 IFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFL 197
            ||      |.|  .|.:|.||     |:......|.|.|.|:....|.|:.::|..|.:..:..|
  Fly   149 IF------RAT--IVLQELGS-----LEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALL 200

  Fly   198 QEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGG 261
            ..:.|.|..|:|::|.....:....:..|||...:|..:..|...|.||:|.:..:.||..|||
  Fly   201 VTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 45/165 (27%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/46 (20%)
SEC14 112..265 CDD:238099 49/174 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.