DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG10237

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:216 Identity:50/216 - (23%)
Similarity:100/216 - (46%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKL 112
            ::|:|:...:..|..:.|.:..|..:.|...::.|....:|  |...:.:.|.:.|.....|.::
  Fly    94 LIRYLRPCKYYPESARDLIKRYYAFKVKHADVYTDLKPSNE--ANIFKHNILTVFPNRDQLGRRI 156

  Fly   113 IFFRMADLDPRTRNSVEET-KIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGG 176
            :...:.......:.:::|. |..|:..:|...:|               |..|. |.|.|.|:.|
  Fly   157 LVLELGKRWKHKQVTLDEVFKGAVLFLEAAMLEP---------------ETQIC-GAVVIFDMDG 205

  Fly   177 YTLRHL-AYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHT 240
            .:|:.. .:...|..|: :.:||::.|.|::|:|::|.|.....:.::..|||:|::|:.|.:|.
  Fly   206 LSLQQTWQFTPPFAKRI-VDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHG 269

  Fly   241 EGMDSLYKEVPRDMLPNEYGG 261
            ...:||:|.:....||..|||
  Fly   270 TDRESLHKYMSPKCLPAAYGG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 40/163 (25%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 4/20 (20%)
SEC14 137..290 CDD:238099 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.