DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG5973

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:270 Identity:60/270 - (22%)
Similarity:109/270 - (40%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DKDSAPETSASPATGWSDKLTDL-------------VAWFEANPNLPEKIEPIVMLRFLKCTAFD 58
            :|:.|||.:...|   .|:|.::             :...|...|||  ::...|:.||:.|.:.
  Fly    27 EKEQAPEWALKKA---QDELREVPGVKEQAIKELRELIQNEKYLNLP--LDDEYMMMFLRPTHYY 86

  Fly    59 VERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPR 123
            .|  .||..|......|..:.....|:...........:.|.:||.....|.:|:.     |:..
  Fly    87 PE--SALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLV-----LEAG 144

  Fly   124 TRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIF 188
            .:....:..:..:....:.|      ..||    :::......|.|.|:|:.|..|.|:...:..
  Fly   145 KKWKPSQVPLVDLFRGIQLT------VLGS----MVEPYSQICGSVVIIDMEGLPLSHITQFTPS 199

  Fly   189 VLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRD 253
            ...:.:.::||....||:|:|::|.....:.|.::..||:||::|..|.:|.:...||...:...
  Fly   200 FAAMLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAK 264

  Fly   254 MLPNEYGGKA 263
            .||.:|||.|
  Fly   265 ALPPKYGGSA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 36/160 (23%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/48 (25%)
SEC14 116..272 CDD:238099 36/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.