DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and retm

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:137 Identity:30/137 - (21%)
Similarity:62/137 - (45%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNM 235
            :||:.|.::|||....|..|...::.::..||..:..:.|:..|.......:::|.|:.|..|:.
  Fly   362 LVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSK 426

  Fly   236 IRYH----TEGMDSLYKEVPRDMLPNEYGG-------KAGTVAELKAKGIQSIRDNAAYLSDERY 289
            ..::    ....|.|.:.:..:::|:..||       :.|.|.:...| :.|:.|:...::.|..
  Fly   427 FLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHEGGLVPKTLYK-MNSLEDHDDEVTAELP 490

  Fly   290 WKVAAQS 296
            ...|||:
  Fly   491 TTAAAQA 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 21/101 (21%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024
CRAL_TRIO 293..456 CDD:279044 19/93 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.