DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG33514

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:275 Identity:75/275 - (27%)
Similarity:128/275 - (46%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DLVA---WFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEM 89
            ||.|   |.|..|:|..:::...::.||:...:.:||.|:..:..|.::.|.|..|...|..|..
  Fly    30 DLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAKSKLDKYYTLKTKYPDYFRVTNTTDSK 94

  Fly    90 TAEGLRVSDLLILPGVTP---QGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERET 151
            ..|..:...::.||  ||   .|.::..:||. |.|     ||:..:...|..|:..:       
  Fly    95 FREIHQTGAIIYLP--TPLNENGPRIGIWRMG-LVP-----VEKYTMLECMQVAQAMQ------- 144

  Fly   152 GSGADYVLDEADIA--EGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCP 214
                :..:.|.|.|  .|.|.|:|:.|.|..||..::..:.:.:..|.:||.|.||:|.|.||..
  Fly   145 ----EIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTI 205

  Fly   215 TYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKA---KGIQS 276
            |..::|.:|..|.:.:::::.:..|...|..|.:::|...||.||||:.||..::.|   |.:..
  Fly   206 TGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGENGTTQDIVAAMEKKLDE 270

  Fly   277 IRD----NAAYLSDE 287
            ..|    |..:.:||
  Fly   271 YADFFQENVNFGTDE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 47/165 (28%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 12/43 (28%)
SEC14 97..253 CDD:238099 48/174 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.