DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG31826

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:289 Identity:57/289 - (19%)
Similarity:96/289 - (33%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DKLTDLVAWFEANPNLPEKIEPI-------VMLRFLKCTAFDVERTKALAELNYCMRNKSP---- 77
            |...:.:...|....|.||.|.:       ::.:||..|.:|..:........|..:.:.|    
  Fly     9 DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVA 73

  Fly    78 --------HLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIF 134
                    .||...:..             .::|.....|..|:.|:..|   ..::..:..:..
  Fly    74 RHPIEHYRQLFYGTHCR-------------YVMPQADRSGRVLVVFKTVD---GFQDYPDYLQSL 122

  Fly   135 VMMSDARFTK----PDVERETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMK 195
            |.|.|..|..    |.|::                .|...|.|:.|.....|...|    ..:||
  Fly   123 VEMDDLIFESLLLLPRVQQ----------------NGITVICDLQGTNRNFLRQFS----PAFMK 167

  Fly   196 FLQE---AYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEG--MDSLYKEVPRDML 255
            .:.|   ..|...:.:|:|.....:....::..||:.:|.:..|..| :|  :..|.:.|..:.|
  Fly   168 VVNEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTH-DGRHLSKLREMVGYESL 231

  Fly   256 PNEYGGKAGTVAELKAKGIQSIRDNAAYL 284
            |.||||.|..|.:.... ...:..||.||
  Fly   232 PAEYGGPATNVLDTNLI-FNHLSQNAEYL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 36/169 (21%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 9/43 (21%)
CRAL_TRIO 92..237 CDD:279044 35/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.