DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG3823

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:268 Identity:107/268 - (39%)
Similarity:173/268 - (64%) Gaps:14/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEM 89
            :::||..|.:|.|.||:.|..:::.|||..|..|:...:.|.||||.:|||..|:|:||:..|..
  Fly    16 RISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPLDAS 80

  Fly    90 TAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSG 154
            :.:.|:|:||:.|||:||:.|||:|:|:.|.|....|.....|:|.|::|.||...:.||     
  Fly    81 SQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVADCRFATENEER----- 140

  Fly   155 ADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDK 219
                     :::|::.:.|:.|||||||...::..|||||||:|||:|.||:.:||:|||:|:||
  Fly   141 ---------LSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVDK 196

  Fly   220 LISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRDNAAYL 284
            :::::.||::.||..:|.:|....|:.|:..||.|||.||||:||.:::||.:.:|.:::...||
  Fly   197 VMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDYL 261

  Fly   285 SDERYWKV 292
            .|...|::
  Fly   262 MDTENWQI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 67/160 (42%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 68/162 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26017
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.