DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG3191

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:315 Identity:119/315 - (37%)
Similarity:191/315 - (60%) Gaps:27/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDTG----------DKDSAPETSASPATGWSDKLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAF 57
            ::||          ::||  :||..........|.:|:.||..|..||::|:|:::.||.:|...
  Fly     7 RETGASGTSEQLQREQDS--DTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFG 69

  Fly    58 DVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDP 122
            |||.|:.|.|:||.:||:.||||:.|:..|..:......:|:|.|||:||...|:..:...:.:.
  Fly    70 DVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEA 134

  Fly   123 RTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADI-AEGDVQIVDIGGYTLRHLAYVS 186
            ...:..|:|:.|.|:||.||..||           .|.:.|: :||:|||.|:.|.|:||::.::
  Fly   135 SKMHHTEDTRAFFMVSDCRFVTPD-----------DLAKPDVLSEGEVQIFDMKGTTMRHISRLT 188

  Fly   187 IFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVP 251
            |..||.|:||||.|:|.||:|:|:||||||||:::|::.||:.:||..:||:||:.:::||:.||
  Fly   189 ISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVP 253

  Fly   252 RDMLPNEYGGKAGTVAELKAKGIQSIRDNAAYLSDERYWKVAAQSK---SRWSWF 303
            |:|||.||||.||::..|:....:::.::..||.|..:|.|....|   |.|.:|
  Fly   254 REMLPEEYGGGAGSLEALRTHTQKALVEHRDYLMDPDHWVVVKPEKRNESSWRFF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 70/161 (43%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 69/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26017
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.