DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CG30339

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:276 Identity:67/276 - (24%)
Similarity:131/276 - (47%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DLVA---WFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEM 89
            ||.|   |....|:|..:.:...::.||:...|.:|:||:..:..|.::...|.|| .:.:.||.
  Fly    29 DLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELF-GKRLVDER 92

  Fly    90 TAEGLRVSDLLILPGVTP---QGNKLIFFRMADLDPRTRNSVEETKIF-VMMSDARFTKPDVERE 150
            .....|....:.||  .|   .|.:|........||:      |.|:. :.......|:..:..:
  Fly    93 NLILCRSGTYVRLP--KPWGTDGPRLQLTNYEKFDPK------EFKLLDLFRYQTMITEQSIRED 149

  Fly   151 TGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPT 215
                     |.::|: |.|:|||:...:|..||.:...:::....|.::|.|:||:.:|:||||.
  Fly   150 ---------DHSNIS-GYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGVHLINCPK 204

  Fly   216 YLDKLISMMSPFLREEVRNMIRYHT-EGMDSLYKEVPRDMLPNEYGGKAGTVAELKAKGIQSIRD 279
            ....|:::....:..:::.  |:|. :.::.|.:.:||:.||.||||..|.:|:::|:..:.:..
  Fly   205 EGVALLNLAKSLMPSKLQQ--RFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAEKKLLS 267

  Fly   280 NAAYLSDERYWKVAAQ 295
            ..:|.:::..:.|..|
  Fly   268 YESYFAEDSQYGVDEQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 41/165 (25%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 12/40 (30%)
CRAL_TRIO 109..250 CDD:279044 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.